PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676767456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YB
Protein Properties Length: 211aa    MW: 24001.4 Da    PI: 6.2325
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676767456genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.33.4e-5632127297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                +eqdrflPianv+rimkkvlP+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyv+plkvyl kyre+egek
  676767456  32 KEQDRFLPIANVGRIMKKVLPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVAPLKVYLGKYRETEGEK 127
                89*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.6E-5526157IPR009072Histone-fold
SuperFamilySSF471135.03E-4234158IPR009072Histone-fold
PfamPF008084.0E-2837101IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.1E-186583No hitNo description
PROSITE patternPS0068506884IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.1E-1884102No hitNo description
PRINTSPR006151.1E-18103121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MTEENPEEDH ESPGAAETNP GSPSSKNNNN SKEQDRFLPI ANVGRIMKKV LPGNGKISKD  60
AKETVQECVS EFISFVTGEA SDKCQREKRK TINGDDIIWA ITTLGFEDYV APLKVYLGKY  120
RETEGEKVNS PKQRQQQQQP QQQLQQNHHF QFQEQDHNNI SCTSYISHHH PSPFMPADHQ  180
PFPNLSFSPK SLQKQFPQQH DNIDSIGQWS A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4532122292Transcription factor HapC (Eurofung)
4g92_B1e-4532122292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7876680.0KC787668.1 Brassica napus transcription factor subunit NF-YB7A (NF-YB7A) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627354.11e-127PREDICTED: nuclear transcription factor Y subunit B-7-like
RefseqXP_013681806.11e-127PREDICTED: nuclear transcription factor Y subunit B-7-like
SwissprotQ9SIT91e-123NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLA0A078DR161e-128A0A078DR16_BRANA; BnaC03g45220D protein
STRINGBra013143.1-P1e-126(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.11e-107nuclear factor Y, subunit B7